PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g011450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 310aa    MW: 34358.6 Da    PI: 7.2919
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g011450.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA641.7e-20228262135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  Csa03g011450.1 228 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 262
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.18E-15222284No hitNo description
SMARTSM004017.2E-20222272IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.084226258IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.4E-15226259IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.32E-17227276No hitNo description
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
PfamPF003202.7E-18228262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MNWLPEQEED FKGILSDDFF DDLINNLDCP LDDEDIDTTN APDEEALDWV AKFQDLEPPP  60
MDMFPSLPSH LTSLAKPARL GVHHSVPPLV KQSNSSEALS GINSTLHQSS SPPDIKVSKL  120
FQSSSPVSVL VNSCDSLSPQ NSRSQGLAFP VKGMRSKRKR PTTMRLNYLF PFDEPKKPEK  180
LTPGGSGSES YYSSEQHAKK KRKIQLTTTH TVSSSFEASN SDGIVRKCTH CETTKTPQWR  240
EGPNGPKTLC NACGVRFRSG RLVPEYRPAS SPTFIPSVHS NSHRKIIEMR RKDDNQFDTS  300
MMHAVISGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488262.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-161GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF880.0R0IF88_9BRAS; Uncharacterized protein
STRINGAT1G08010.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-142GATA transcription factor 11